[Beliaf]

Newsensations.com- Alexis Monroe - Little Angels





Description:

Sweet and tart Blond Alexis Monroe is dripping wet in need of some rim jobbing and hard fucking. We peel off her panties and lick up her booty juice and stuff her young hot mouth full of cock. Alexis spread her pink pussy wide and took all our inches deep inside and loved getting cock doggy style until we blew our massive dose of man into her mouth.
Model:
Alexis Monroe, Mike Adriano
Studio:
Newsensations.com
Info:
File Name : alexis_monroe_littleangels_1440.mp4
File Size : 2569.49 MB
Resolution : 1280x720
Duration : 00:58:22
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:jb-alexis_monroe_mike_adriano_LittleAngels_1440.zip - 10.4 MB

Download VIDEO:
UbiqFile:alexis_monroe_littleangels_1440.mp4 - 2.5 GB

[Beliaf]

Newsensations.com- Dani Jensen - So Young So Sexy P.O.V. 02





Description:

Dani Jensen is simply a cutie pie and when it was time for her birthday she decided to give all of us a gift. Dani Jensen_s gift to us is her tight wet pussy getting pounded deep and hard by some summer sausage. In the end though it isn_t just Dani_s birthday cake that ends up frosted
Model:
Dani Jensen, Mike Adriano
Studio:
Newsensations.com
Info:
File Name : dani_jensen_mike_adriano_soyoungsosexy-02.mp4
File Size : 404.72 MB
Resolution : 1280x720
Duration : 00:34:42
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-dani_jensen_SoYoungSoSexy02_1440.zip - 23.0 MB

Download VIDEO:
UbiqFile:dani_jensen_mike_adriano_soyoungsosexy-02.mp4 - 404.7 MB

[Beliaf]

Newsensations.com- Bobbi Starr - Stretched Out Snatch 08





Description:

After an afternoon date Bobbi Starr and Shane have one thing on their mind...Fucking Bobbi starts off sucking Shane_s cock in the car but they soon move into the house for more room. Once inside Bobbi is bent over and rammed with thick black cock. Not scared of the size, Bobbi climbs on and goes to town slamming her hot fuck hole up and down his shaft. Bobbi is in heaven with all this meat crammed inside of her hitting her sweet spot that makes her shiver with orgasm Which is enough to make Shane lose his load all over her belly
Model:
Bobbi Starr, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : bobbi_starr_stretchedoutsnatch08.mp4
File Size : 1061.01 MB
Resolution : 1280x720
Duration : 00:24:11
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-bobbi_starr_StretchedOutSnatch08_16x9.zip - 27.3 MB

Download VIDEO:
UbiqFile:bobbi_starr_stretchedoutsnatch08.mp4 - 1.0 GB

[Beliaf]

Newsensations.com- Brittany Young - Shane Diesel_s Cuckold Stories 5





Description:

Blond juicy jugged Britney Young is in need of thicker and harder cock inside her pussy. Shane takes on the challenge of stuffing her tight pink pussy by filling her mouth first. Britney could barely fit every inch of Shane_s meat and wanted him balls deep. Shane fucked her wide and sprayed her with his snake juice.
Model:
Britney Young, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : britney_young_shane_diesel_shanedieselscuckoldstor ies05.mp4
File Size : 343.68 MB
Resolution : 1280x720
Duration : 00:29:21
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-britney_young_shane_diesel_ShaneDieselsCuckoldStor ies05_1920.zip - 8.7 MB

Download VIDEO:
UbiqFile:britney_young_shane_diesel_shanedieselscu ckoldstories05.mp4 - 343.7 MB

[Beliaf]

Newsensations.com- Britney Young - Pretty.Dirty 2





Description:

Britney Young is one pretty...dirty girl Don_t let the innocent look fool you. Once Britney gets down and dirty all she can think of is a big hard cock to suck and fuck. Cum bust a load for this little tight spinner and see why shes one pretty dirty girl
Model:
Britney Young, Tyler Nixon
Studio:
Newsensations.com
Info:
File Name : britney_young_tyler_nixon_prettydirty.mp4
File Size : 312.37 MB
Resolution : 1280x720
Duration : 00:26:40
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-britney_young_tyler_nixon_PrettyDirty02_1920.zip - 7.0 MB

Download VIDEO:
UbiqFile:britney_young_tyler_nixon_prettydirty.mp4 - 312.4 MB

[Beliaf]

Newsensations.com- Gisselle - MILF Date 4





Description:

Gisselle has cum for a mouth and pussy stretching of a lifetime. Shane unleashes the zipper beast for Gisselle to mop on and spreads her pussy wide for entrance, as he gently shoves in his massive inches. Poor Gisselle took the cock plowing deep up to his balls in her pink and stood tall to take all the hot ball gravy Shane had to spray her mouth with.
Model:
Gisselle, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : gisselle_shane_diesel_milfdate04.mp4
File Size : 273.4 MB
Resolution : 1280x720
Duration : 00:23:24
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-gisselle_MilfDate04_16x9.zip - 27.2 MB

Download VIDEO:
UbiqFile:gisselle_shane_diesel_milfdate04.mp4 - 273.4 MB

[Beliaf]

Newsensations.com- Allyssa Hall - Screw My Girlfriend While I Watch





Description:

Allyssa Hall has decided to fulfill her boyfriends fantasy and let another man fuck her stupid while he watches. The surly chap arrives promptly and proceeds to cram his enormous cock deep within every available orifice. The boyfriend watches with wide eyes as the surrogate blows a mammoth load into her grinning grill.
Model:
Allyssa Hall, Tommy Gunn
Studio:
Newsensations.com
Info:
File Name : allyssa_hall_screwmygirlfriendwhileiwatch.mp4
File Size : 1923.06 MB
Resolution : 1280x720
Duration : 00:43:52
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:jb-allyssa_hall_SMGWIW_16x9.zip - 28.4 MB

Download VIDEO:
UbiqFile:allyssa_hall_screwmygirlfriendwhileiwatch .mp4 - 1.9 GB

[Beliaf]

Newsensations.com- Eden Adams - Keepin_ It Fresh 03





Description:

Sweet young babe Eden Adams is crazy for cock and when her man is not meeting her needs she gives us a call. We come right over and get to the fucking With her mouth full of our meat, Eden works in and out of her throat for one hell of a blow job. Eden really likes to be fucked hard and our meat gives her everything she wants. There_s nothing like a girl who enjoys a good pussy slam and a face full of sticky goo
Model:
Eden Adams, Jordan Ash
Studio:
Newsensations.com
Info:
File Name : eden_adams_jordan_ash_keepin-itfresh-03.mp4
File Size : 286.67 MB
Resolution : 1280x720
Duration : 00:24:27
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:ns-eden_adams_jordan_ash_KeepinItFresh03_16x9.zip - 50.7 MB

Download VIDEO:
UbiqFile:eden_adams_jordan_ash_keepin-itfresh-03.mp4 - 286.7 MB

[Beliaf]

Newsensations.com- Maya Hills - She Only Takes Diesel 03





Description:

This tiny blonde is about to get her pussy wrecked. Maya Hills had heard the rumors and now is about to find out that they are true Maya wraps her lips around this giant black shaft, sucking and licking as her spit runs down her chin. Once we flip her over we have a clear shot at her tight twat. Cramming our cock deep inside, we drill her pink velvet tunnel leaving her tore up pussy gapping With her pussy sore and our cock chowder dripping from her chin, Maya goes home a happy girl
Model:
Maya Hills, Shane Diesel
Studio:
Newsensations.com
Info:
File Name : maya_hills_shane_diesel_sheonlytakesdiesel03.mp4
File Size : 1254.53 MB
Resolution : 1280x720
Duration : 00:28:30
Video : AVC (AVC), 6 000 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (CBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:sdbb-maya_hills_shane_diesel_SOTD03_clip0116x9.zip - 29.1 MB

Download VIDEO:
UbiqFile:maya_hills_shane_diesel_sheonlytakesdiese l03.mp4 - 1.2 GB

[Beliaf]

Newsensations.com- Kylee Lovit - MILF Date 4





Description:

Mmmm...Kylee Lovit and her bodacious honey chest...nom nom. Kylee set the girls free and our zipper let the love muscle flex and tear into those tits. After hours of her sucking and tit fucking we moved into that dripping wet pussy of hers and dug in ball deep. Our cock was in melon heaven and pink blessings until her juggs were calling, for a gallon load of tit protein man cream.
Model:
Domenic Kane, Kylee Lovit
Studio:
Newsensations.com
Info:
File Name : kylee_lovit_domenic_kane_milfdate04.mp4
File Size : 327.34 MB
Resolution : 1280x720
Duration : 00:27:53
Video : AVC (AVC), 1 500 Kbps, 29.000 fps
Audio : AAC (AAC LC), 128 Kbps (VBR), 48.0 KHz, 2 channels, 1 stream

Download Screenshots:
UbiqFile Zip:um-kylee_lovit_MilfDate04_16x9.zip - 24.1 MB

Download VIDEO:
UbiqFile:kylee_lovit_domenic_kane_milfdate04.mp4 - 327.3 MB