[KEEP2POST]

Newsensations.com- Dee Rose - Dirty Little Schoolgirl Stories 01




Description:

Dee Roze is notorious for getting into mischief, but when mischief gets into her-that_s worth watching. When she_s caught surfing a little online porn, the adult of the house is made to reprimand her. In the midst of his speech, she grabs his cock and turns the tables to a more enjoyable scenario.

Model:
Christian XXX, Dee Rose

Studio:
Newsensations.com

Info:
File Name : dee_roze_christian_dirtylittleschoolgirlstories-01.mp4
File Size : 232.63 MB
Resolution : 1280x720
Duration : 00:19:56
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 128 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: dee_roze_christian_dirtylittleschoolgirlstories-01.mp4

[KEEP2POST]

Newsensations.com- Danica Blue - Sex In My PJ_s 1




Description:

Danica Blue tends to wake up horny, which is just fine for her bald-headed beau. I mean who doesn_t like being woken up with a little head? After lubing up his fuck stick, she pulls down her PJ_s for a bit of the old in-out, in-out. Later, our cock gives her a nice facial to start the day.

Model:
Christian XXX, Danica Blue

Studio:
Newsensations.com

Info:
File Name : danica_blue__inmypjs01.mp4
File Size : 260.51 MB
Resolution : 568x320
Duration : 00:24:25
Video : AVC, 1 400 kb/s, 29.000 FPS
Audio : AAC, 92.2 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: danica_blue_sexinmypjs01.mp4

[KEEP2POST]

Newsensations.com- Dani Jensen - Trade School Sluts




Description:

Dani Jensen is a girl with a master plan. Her plan is to become a plumber cause she wants to clean pipes. She scores with this guy when she gets hired to check his plumbing. She checks it alright. Drains that pipe properly using any means necessary. From her lips to her hips she makes sure her job is done and done very well.

Model:
Dani Jensen, Johnny Castle

Studio:
Newsensations.com

Info:
File Name : dani_jensen_trade-school-_s.mp4
File Size : 363.02 MB
Resolution : 1280x720
Duration : 00:31:55
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 92.2 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: dani_jensen_trade-school-_.mp4

[KEEP2POST]

Sextwoo Bathroom Sex With Open Mouth Facial

[KEEP2POST]

Newsensations.com- Sadie West - All About Sadie 01




Description:

Today is a special day, fir the first time I get to please two cocks at once. I soon find myself with two hard shafts getting crammed down my throat. This being my first time with two cocks at once, my pussy was dripping wet and begging to be fucked. I suck hard on one cock as the other pounds my pleasure hole. I have never felt anything like this before, stuffed full of cock from both ends I don_t think i_ll ever be the same again. And for an added bonus that comes with fucking and sucking two cocks is that I get twice the hot man gravy blasted all over my face

Model:
Alex Gonz, Anthony Rosano, Sadie West

Studio:
Newsensations.com

Info:
File Name : sadie_west_alex_gonz_anthony_rosano_allaboutsadie-01.mp4
File Size : 462.7 MB
Resolution : 1280x720
Duration : 00:39:40
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 129 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: sadie_west_alex_gonz_anthony_rosano_allaboutsadie-01.mp4

[KEEP2POST]

Newsensations.com- Amber Sun - Screw My Girlfriend While I Watch




Description:

Amber Sun has an appetite for unconventional sex that is second to none. When it came to asking her boyfriend to watch while she fucked another guy, she was a little apprehensive. Fortunately her beau was totally into it and they arranged to make her fantasy a reality

Model:
Amber Sun, Mikey Butders

Studio:
Newsensations.com

Info:
File Name : amber_sun_screwmygirlfriendwhileiwatch.mp4
File Size : 346.08 MB
Resolution : 568x320
Duration : 00:32:13
Video : AVC, 1 400 kb/s, 29.000 FPS
Audio : AAC, 92.2 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: amber_sun_screwmygirlfriendwhileiwatch.mp4

[KEEP2POST]

Newsensations.com- Alexis Love - Ashlynn Goes To College 1




Description:

Alexis Love in trouble again for bad homework must be reminded of her lessons. With the teachers cock in her wet mouth Alexis sucks like a good girl she is. When his cock is nice and hard he shoves it in her tight hot pussy. Alexis rides his pole_grinding as it slips in and out. Fucking her rough on his desk he drills the lesson into her and finishes with blowing warm jizz all over her.

Model:
Alexis Love, Steven St. Croix

Studio:
Newsensations.com

Info:
File Name : alexislove_stevenstcroix_ashlynngoes-tocollege01.mp4
File Size : 194.37 MB
Resolution : 1280x720
Duration : 00:16:34
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 128 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Tezfiles VIDEO:
Tezfiles Video: alexislove_stevenstcroix_ashlynngoes-tocollege01.mp4

[KEEP2POST]

Newsensations.com- Sexy Vanessa - MILFs Who Love Black Cock 02




Description:

Sexy Vanessa is used to getting whatever she wanted whenever she wanted. So when Sexy Vanessa wanted some new dick, she went for what she loves....big fat thick black cock. Cum see Sexy Vanessa as she works some black dick with her skilled hands, mouth and every so wet pussy until it is milked of every drop of sweet white chocolate

Model:
Mr. Marcus, Sexy Vanessa

Studio:
Newsensations.com

Info:
File Name : _y_vanessa_milfs-wholoveblackcock02.mp4
File Size : 274.28 MB
Resolution : 1280x720
Duration : 00:23:26
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 128 kb/s (CBR), 48.0 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: sexy_vanessa_milfs-wholoveblackcock02.mp4

[KEEP2POST]

Newsensations.com- Anastasia - Dude Your Girlfriend Is In A Porno 1




Description:

Heavenly melonly chested Anastasia shares her tits with us two hard cocks. Anastasia sucks us stiff and spreads her European pussy for all of the cock while sucking the other. After a while she needed both cocks at once, one in her ass and the other in her pink pussy. Anastasia took every pulsing inch and bathed in both massive hot loads of ball protein juice.

Model:
Anastasia Devine

Studio:
Newsensations.com

Info:
File Name : anastasia_dudeyourgirlfirendsina__4x3.mp4
File Size : 88.93 MB
Resolution : 480x360
Duration : 00:26:53
Video : AVC, 384 kb/s, 29.000 FPS
Audio : AAC, 74.6 kb/s (VBR), 44.1 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: anastasia_dudeyourgirlfirendsinaporno_4x3.mp4

[KEEP2POST]

Newsensations.com- Payton Leigh - Cheating Wives Tales 09




Description:

Payton Leigh loves sex so much that she will take it from any man that comes her way. So when the hubby is away and some fresh meat shows interest in making Payton Leigh shiver, she jumps on that hard cock and gets a pussy pounding until she gets a blast of man gravy

Model:
Marco Banderas, Payton Leigh

Studio:
Newsensations.com

Info:
File Name : payton_leigh_marco_banderas_cheatingwivestales09_1 440.mp4
File Size : 366.23 MB
Resolution : 1280x720
Duration : 00:31:15
Video : AVC, 1 500 kb/s, 29.000 FPS
Audio : AAC, 128 kb/s (CBR), 22.05 kHz, 2 channels, 1 stream

Download Screenshots RAR Tezfiles:
Tezfiles RAR:

Download Tezfiles VIDEO:
Tezfiles Video: payton_leigh_marco_banderas_cheatingwivestales09_1 440.mp4